PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00032710-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MYB_related
Protein Properties Length: 88aa    MW: 10258.9 Da    PI: 10.3626
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00032710-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.45.3e-11536132
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg 32
                      +g+WT+eEd++l+  +k++G g+W++ +++ g
  PSME_00032710-RA  5 KGAWTAEEDQILISFIKKHGHGNWHALPNKAG 36
                      79************************999988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.65150IPR017930Myb domain
SuperFamilySSF466892.97E-9136IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-12336IPR009057Homeodomain-like
SMARTSM007170.0046445IPR001005SANT/Myb domain
PfamPF002495.6E-9536IPR001005SANT/Myb domain
CDDcd001672.11E-6736No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 88 aa     Download sequence    Send to blast
MGLKKGAWTA EEDQILISFI KKHGHGNWHA LPNKAGLYCA RLSKYLFARI KTNSIVFFYL  60
SRRTYAMREE LSTALDKLSQ TQHKTWEL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ7XBH49e-14MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLA0A068F4953e-15A0A068F495_9R
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.12e-15myb domain protein 15